NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211525_10207598

Scaffold Ga0211525_10207598


Overview

Basic Information
Taxon OID3300020423 Open in IMG/M
Scaffold IDGa0211525_10207598 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000315 (ERX556027-ERR599062)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)826
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_037
CoordinatesLat. (o)20.8188Long. (o)63.6158Alt. (m)Depth (m)600
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051977Metagenome / Metatranscriptome143Y
F097505Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0211525_102075981F051977N/ATEKEYRKIYHRIDKEVMHSAPILDIFMKEDKKLWVVTKITKNKERPQLGRSIVHFVNGTVFDYSDGKERRVGGCTNCKDVMFNPKGVGKVEFFPKKLRGAELEIRVDRFYGMPPNKKVVLDQSKRFYDISRDRLNFIVKNKDGL
Ga0211525_102075983F097505N/AHDVVSSVLEYFIITPMFATAYLAVTVPWMLFVIKLDGEQFTDFIWQSVLVDLIVAYPVTKLILKLKPRIEKITSLRH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.