Scaffold Ga0211525_10116323

Overview

Basic Information

• Taxon OID: 3300020423
• Scaffold ID: Ga0211525_10116323
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000315 (ERX556027-ERR599062)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1178
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_037
• Coordinates
  • Lat. (^o): 20.8188
  • Long. (^o): 63.6158
  • Depth (m): 600

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023616	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211525_101163233	F023616	AGG	MNSAVDKPNHPALKALPLDFVKYLEIIVEPVCVIIPWPENLINKIPINNKITDDIFEKKKQENDKRIITKRENLKTFTSSIFFPTQINNKLLHNVADA