Scaffold Ga0211702_10061309

Overview

Basic Information

• Taxon OID: 3300020422
• Scaffold ID: Ga0211702_10061309
• Source Dataset Name: Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1033
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_076
• Coordinates
  • Lat. (^o): -21.0073
  • Long. (^o): -35.3344
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007226	Metagenome / Metatranscriptome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211702_100613092	F007226	AGGAGG	LQKLLNKITLYFLNRAYEQMEAAGDLQNADDVAEHIEDYFTYFVKK