Scaffold Ga0211653_10026154

Overview

Basic Information

• Taxon OID: 3300020421
• Scaffold ID: Ga0211653_10026154
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2730
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_102
• Coordinates
  • Lat. (^o): -5.2476
  • Long. (^o): -85.3343
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008152	Metagenome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211653_100261547	F008152	AGGA	MSEEEYDGLLWYKESIERMSWDEIQELMHERIANGSWNKFVETLGKPPHVIKHDYLLRKMNESNIKE