Basic Information | |
---|---|
Taxon OID | 3300020420 Open in IMG/M |
Scaffold ID | Ga0211580_10051985 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1745 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_132 | |||||||
Coordinates | Lat. (o) | 31.493 | Long. (o) | -159.0606 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F085816 | Metagenome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211580_100519853 | F085816 | N/A | WTSTNNSYPQHMKKNNTVYKNYIFLAYKSAFLKIIVNIEICFPNSILNIGTK |
⦗Top⦘ |