Scaffold Ga0211512_10197048

Overview

Basic Information

• Taxon OID: 3300020419
• Scaffold ID: Ga0211512_10197048
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 925
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_004
• Coordinates
  • Lat. (^o): 35.5571
  • Long. (^o): -6.5586
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007227	Metagenome / Metatranscriptome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211512_101970483	F007227	N/A	WLLNPHDHHLLYVRDDGSFYGFTHMKGEDPEEWFWEAHGIQTELFPPEPPKSHKFTQEQLDRAPHHNMLEKYYGKDWKPKPVEGLAPHF