Scaffold Ga0211557_10001533

Overview

Basic Information

• Taxon OID: 3300020418
• Scaffold ID: Ga0211557_10001533
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16430
• Total Scaffold Genes: 32
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 18 (56.25%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_142
• Coordinates
  • Lat. (^o): 25.5416
  • Long. (^o): -88.4044
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048928	Metagenome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211557_100015333	F048928	AGGAGG	MAFENAFTGRLVLFNNQQKKSDKSPDMSGSVEFSLQDAMAFADWITGQGGEENYKGEKVVKVPVSAWHTQSKNGTGFISGQMAAQKIQAEMDEIPF