NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211528_10007595

Scaffold Ga0211528_10007595


Overview

Basic Information
Taxon OID3300020417 Open in IMG/M
Scaffold IDGa0211528_10007595 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6462
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_038
CoordinatesLat. (o)19.0108Long. (o)64.532Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052547Metagenome / Metatranscriptome142N
F073533Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0211528_100075955F052547GAGGMGIVTDNKSHAQADKDFDLSFSEGHEIKVQFNCEILSGCEFKCKGCFVNKLGSNVGDFQRLNDAIDLFNENGYRVSTINIGPTDIFGNNNVLELLQDEIFRECLSKVTTIQFVTTLSEQIDLRVIDLLNSIPKKEGFMYDCNVVVEHPVIWGSLQSRLNMLNLFEDDLNYYFVYNMGNDDEDNEKVLDLSKVTDRYFDTILQLNPSFFRAPKSKVQKHMIEKWKSYDFSHDMYPKTIADQAQGGSLELNFTYCNERFFWTPFVYDIVMIGTDEYEVKEEWDINSWTKVKEDQFIKQLSYASKTNMCASCPKQMTCIDKGVLSYMEYHELTECVYPKYVRD
Ga0211528_100075958F073533N/AIFDAQNFEEIMNHEYMFKLYEISAIGFTSTLLQPYWVIKSKLEKIWSLYAHIKRVPDIDFKIVLDVDKYLDGELDDWYKKLKLFVNGSVQFRVNYYKGVFDRISYNELCQKAYDDFHAPVVITPSFLTDRNARGKVEQHLANFRKDMLDQKIDDKWKEYYTFFDAKFNGYGCQNYSFYNGKLYINPFLYDAIIQRTPFFETTMDENKLYDNIEYAQQVDDCNGCEYMMSCAERNVHMYMESRDLNSCVAIKEYMYAPH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.