Scaffold Ga0211523_10414245

Overview

Basic Information

• Taxon OID: 3300020414
• Scaffold ID: Ga0211523_10414245
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 544
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_036
• Coordinates
  • Lat. (^o): 20.8199
  • Long. (^o): 63.5138
  • Depth (m): 17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008152	Metagenome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211523_104142453	F008152	AGGA	MAEEYDTLGWYKDTIKRMSWDEIQELMEERIKNGSWNKFVETLGKPPHVIKHDHF