Scaffold Ga0211552_10176646

Overview

Basic Information

• Taxon OID: 3300020412
• Scaffold ID: Ga0211552_10176646
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001167 (ERX556053-ERR599047)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 756
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_146
• Coordinates
  • Lat. (^o): 34.6054
  • Long. (^o): -71.2317
  • Depth (m): 640

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003507	Metagenome / Metatranscriptome	482	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211552_101766462	F003507	N/A	TVEADRNQAHFVLPEVLSQFRTKLDASLMEELLQIQATFAMEQGLVSPSHLMVDTFASEQGSQRVNDAATLYKAKKKSSRSSKQ