| Basic Information | |
|---|---|
| Taxon OID | 3300020411 Open in IMG/M |
| Scaffold ID | Ga0211587_10282240 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 684 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_042 | |||||||
| Coordinates | Lat. (o) | 5.9997 | Long. (o) | 73.914 | Alt. (m) | Depth (m) | 80 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F095609 | Metagenome / Metatranscriptome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211587_102822401 | F095609 | GAGG | MNVNKHKNVENVIRYFLLFLPPKGRRSILDIGSGVSCPYRGVLEGHYTDGVYSGRLGAGGKYAALDIRGAPPNVDYVMDLTEGTPFEDNEWEWGWCSEVIEHIEPEKKKIFVDEALRICENIVFTFPTPKLAEVFYDDPGHTEVKIDFQQEYSSTHKITDKSTQNGRAIIIMNKLFDGKVIVHPPYDNGCNLTEHFE |
| ⦗Top⦘ |