Scaffold Ga0211587_10013504

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211587_10013504

Scaffold Ga0211587_10013504

Overview

Basic Information
Taxon OID	3300020411 Open in IMG/M
Scaffold ID	Ga0211587_10013504 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4276
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (30.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_042
Coordinates	Lat. (^o)	5.9997	Long. (^o)	73.914	Alt. (m)		Depth (m)	80
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085581	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211587_100135046	F085581	GAGG	LKKILNKVSNPELPPNVSVFQDHLALGLECFDLDWFDFRPHTCNHKEWGNGILFSQVDRKHTDSCAAEESLIVSNEGLHLPNKQMLPFSNEQPPTKMALLVLAAMVLQAPLNFEPCPDCN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.