| Basic Information | |
|---|---|
| Taxon OID | 3300020410 Open in IMG/M |
| Scaffold ID | Ga0211699_10431289 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 523 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_076 | |||||||
| Coordinates | Lat. (o) | -21.0675 | Long. (o) | -35.3923 | Alt. (m) | Depth (m) | 150 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028201 | Metagenome / Metatranscriptome | 192 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211699_104312892 | F028201 | N/A | MIEYNQKQSKEIYNALLDSKVDLLEYFLGPDPKKTSYYKKHIKRYRVKSILNDY |
| ⦗Top⦘ |