NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211699_10334664

Scaffold Ga0211699_10334664


Overview

Basic Information
Taxon OID3300020410 Open in IMG/M
Scaffold IDGa0211699_10334664 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)594
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_076
CoordinatesLat. (o)-21.0675Long. (o)-35.3923Alt. (m)Depth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019668Metagenome228N

Sequences

Protein IDFamilyRBSSequence
Ga0211699_103346642F019668N/AMWYYIDMIDNKQINEVDMTSKYNKQTIDYVGVSDGNDSFGFYFTTKENDDIVYTNSWLLKDLVFALRTKYNLGSTYMASSSMDFATESGFYHNGAAAHVLTLASNIAESGKTIAEYTKKKLTENVDIREIEFGSLKKEEAEDWYTDGKVAFNN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.