NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211651_10121594

Scaffold Ga0211651_10121594


Overview

Basic Information
Taxon OID3300020408 Open in IMG/M
Scaffold IDGa0211651_10121594 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1061
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_109
CoordinatesLat. (o)2.0596Long. (o)-84.553Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005351Metagenome / Metatranscriptome403Y
F009959Metagenome / Metatranscriptome310Y
F041211Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0211651_101215942F009959N/AMTEQEVIDKVCDRVVNTIYNELDYYMFEFLGYTETNEQYVKDADKLINKIINNLTK
Ga0211651_101215944F041211N/AMNNINTTIDKIAMSEFDMHYYQLSDNEKQWCHDEMVNNPKWLNPPFESEVEKWFITN
Ga0211651_101215945F005351N/AYKLIKLITMYNVNNPSNWSWSKAFDEMDKTINQAELEQQIMNHLSNYSGNPKWTELTKNQQEDHYTILTELL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.