Scaffold Ga0211668_10038371

Overview

Basic Information

• Taxon OID: 3300020406
• Scaffold ID: Ga0211668_10038371
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2202
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_099
• Coordinates
  • Lat. (^o): -21.1556
  • Long. (^o): -104.8217
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037684	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211668_100383717	F037684	GAGG	MNINPNKKYKFIDKDLVNGFVVLTGKELNAILEKSYKEHMEFKNEIN