Scaffold Ga0211659_10307592

Overview

Basic Information

• Taxon OID: 3300020404
• Scaffold ID: Ga0211659_10307592
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 697
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H34 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_102
• Coordinates
  • Lat. (^o): -5.254
  • Long. (^o): -85.2248
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082531	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211659_103075921	F082531	GGAG	LTQSVNPLTEMEDQDIEMFIKAFDDFMKHAETEIDSHKKWKEAEEYTNRYFEEKAAEMEVTVDYYMQEFL