Scaffold Ga0211499_10122357

Overview

Basic Information

• Taxon OID: 3300020402
• Scaffold ID: Ga0211499_10122357
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 954
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_056
• Coordinates
  • Lat. (^o): -15.331
  • Long. (^o): 43.2908
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095595	Metagenome / Metatranscriptome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211499_101223573	F095595	N/A	MVDNIVYGAGGIPMVKQPNEVKPVEKTAAPKKEKKQPLQEIYGEGEKDPDGFDEEHGDKA