Scaffold Ga0211617_10494061

Overview

Basic Information

• Taxon OID: 3300020401
• Scaffold ID: Ga0211617_10494061
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_052
• Coordinates
  • Lat. (^o): -17.2387
  • Long. (^o): 53.9775
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037767	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211617_104940611	F037767	N/A	TGRQLTIGTGTSKTTFFPDGDTFTGEASSDLGDVVAYVYYNEPINVTGTPQLQLKQATALGSTFGTIMDFSSSFSDLTNGIMAFALPAGEDTRTSNVTNNTLGVNSDDAISLNSGTIEKMTGDRIVLEDVIAAYGDNDSEAGINLENEHGHLLEEAGGGMPADLTL