Scaffold Ga0211617_10177032

Overview

Basic Information

• Taxon OID: 3300020401
• Scaffold ID: Ga0211617_10177032
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 889
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_052
• Coordinates
  • Lat. (^o): -17.2387
  • Long. (^o): 53.9775
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031481	Metagenome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211617_101770322	F031481	GGAG	MQVGDLVKRQQGWQGWKRQQLGLVVNVDRAVIKVQWSGDYGTFSHPITSLEVLNERR