NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211636_10002809

Scaffold Ga0211636_10002809


Overview

Basic Information
Taxon OID3300020400 Open in IMG/M
Scaffold IDGa0211636_10002809 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10278
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (58.82%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_122
CoordinatesLat. (o)-8.9721Long. (o)-139.2742Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001656Metagenome / Metatranscriptome656Y
F032083Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0211636_1000280917F032083N/ARTLKSFITPEALKTLADFKSKQLGYNTVYKEELTK
Ga0211636_100028096F001656AGGAGMPITRNRSTDMIRRQAYNGKGLTFIEVIFAQSNTDSATAPESNDSVFDQVTKVVNKNGTLLASSYRLGAKATANDAAEASEITANNSIDSFQYIVEGTPGQFNAADSAGDVNMDVDATVIADAEADIEADIRAVLDSDSSNNTQHVKVRTLLPEGSVNGTADTIIGMFDQRGDA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.