Scaffold Ga0211623_10023270

Overview

Basic Information

• Taxon OID: 3300020399
• Scaffold ID: Ga0211623_10023270
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2110
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_068
• Coordinates
  • Lat. (^o): -31.056
  • Long. (^o): 4.6606
  • Depth (m): 700

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004191	Metagenome / Metatranscriptome	449	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211623_100232701	F004191	N/A	MFKEIMTTIFAVLGVLLLVGATGAVETDQWFLGFTYMIMGVSSMFISIITQEGVK