Scaffold Ga0211637_10231868

Overview

Basic Information

• Taxon OID: 3300020398
• Scaffold ID: Ga0211637_10231868
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 735
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_112
• Coordinates
  • Lat. (^o): -23.1719
  • Long. (^o): -129.6713
  • Depth (m): 696

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019228	Metagenome / Metatranscriptome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211637_102318682	F019228	GGAG	MKKKVGKRKRKGWRKRSPRCTLCTAIRWMGNIKGRHPMRELKQLQKEKYADIRI