Scaffold Ga0211583_10008684

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211583_10008684

Scaffold Ga0211583_10008684

Overview

Basic Information
Taxon OID	3300020397 Open in IMG/M
Scaffold ID	Ga0211583_10008684 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4771
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (73.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_042
Coordinates	Lat. (^o)	6.0124	Long. (^o)	73.8985	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087297	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211583_100086845	F087297	AGGAG	MPTLIQYKIIDGFNEYNDYLIHKDDIDESDDENLIIDLIGGDRDEGDYRSIEVVYTKSIGIKDAEFLQECFIAFPYGGGEWLRQLAIKKRSE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.