Scaffold Ga0211687_10067269

Overview

Basic Information

• Taxon OID: 3300020396
• Scaffold ID: Ga0211687_10067269
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1568
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_082
• Coordinates
  • Lat. (^o): -47.1208
  • Long. (^o): -57.8265
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072751	Metagenome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211687_100672691	F072751	AGGA	MEFINKEPRRTFPIPGWAKNLAHDESRMWLMNNAEIYHVQELISVCEFNKLQLIERALGSPFSEFSTEECNELFERIEVQLKDLEDHLESIRLKNQKIKDELGDDWLKEKH