| Basic Information | |
|---|---|
| Taxon OID | 3300020396 Open in IMG/M |
| Scaffold ID | Ga0211687_10041632 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2115 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_082 | |||||||
| Coordinates | Lat. (o) | -47.1208 | Long. (o) | -57.8265 | Alt. (m) | Depth (m) | 40 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009608 | Metagenome / Metatranscriptome | 315 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211687_100416323 | F009608 | N/A | MKHIKLFEQFLNEARPMFQDTPNELAYLDFKKWAYKKRGDIKKRLKDIDDGSKFFIELQSIWKDWANKNAKEWSYLHATSVARKDFGRALAIMLKADDLIIKKSGNKLIDLK |
| ⦗Top⦘ |