Scaffold Ga0211497_10031476

Overview

Basic Information

• Taxon OID: 3300020394
• Scaffold ID: Ga0211497_10031476
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2479
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_058
• Coordinates
  • Lat. (^o): -17.5656
  • Long. (^o): 42.1988
  • Depth (m): 66

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009035	Metagenome / Metatranscriptome	324	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211497_100314763	F009035	AGGAG	MVDGIVIQILFCLLIIVYWFSEGVTEGWTWSTKKRKETNKLIHPNNKSNGIFDYHMWRILENVGIWGAVILAFLMEGSFEKFFWLGVGSWFIGTFCYEAALNHVNKGTIYKPVDYKWHILGYDIPWWGGKKIFILPATGLAILLYGILI