Scaffold Ga0211666_10060151

Overview

Basic Information

• Taxon OID: 3300020392
• Scaffold ID: Ga0211666_10060151
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1600
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_100
• Coordinates
  • Lat. (^o): -12.9488
  • Long. (^o): -96.0293
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010091	Metagenome / Metatranscriptome	308	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211666_100601512	F010091	GAG	MNIDELLLEAEQGKRSPILARITKEALPFWEGCEAKVLNGTSIKPYVVMRLLKEHFNVKISESAIRNHFENLAASNGK