Scaffold Ga0211675_10008269

Overview

Basic Information

• Taxon OID: 3300020391
• Scaffold ID: Ga0211675_10008269
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5836
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_096
• Coordinates
  • Lat. (^o): -29.6749
  • Long. (^o): -101.2137
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051480	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211675_100082693	F051480	N/A	MENWCRLGCSKFFRGLIASRQPEEIIKLVERYNKDHDKTESNYIDIVIRSEGSFSYQDIMTMPVNSIRLLVERMNNRIEELNKQSKQASGRR