NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211678_10118708

Scaffold Ga0211678_10118708


Overview

Basic Information
Taxon OID3300020388 Open in IMG/M
Scaffold IDGa0211678_10118708 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1156
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_093
CoordinatesLat. (o)-33.8785Long. (o)-73.0369Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023860Metagenome / Metatranscriptome208N
F027854Metagenome / Metatranscriptome193N

Sequences

Protein IDFamilyRBSSequence
Ga0211678_101187082F027854AGGAMTDQEAIKLHELIDELRAKLQKSLKEVLQLRKDLDLEREEHQLTQLRYNNVKNAINKEVDRLNQRRPDVEIPADEPVYKKDLK
Ga0211678_101187084F023860GAGGMDKMKDMFELRNAVRHFLEDKLEAKVQGAGMSITEPSSADISFKIDNTNYVLTIDEV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.