Scaffold Ga0211498_10093681

Overview

Basic Information

• Taxon OID: 3300020380
• Scaffold ID: Ga0211498_10093681
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1128
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_057
• Coordinates
  • Lat. (^o): -17.0283
  • Long. (^o): 42.7449
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002137	Metagenome / Metatranscriptome	590	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211498_100936812	F002137	GGAGG	MKVKELIEWLSLQDRDDDLTFYFLKNDVLTNCQLETIIETDMGVELTIQDTEELQNEF