Basic Information | |
---|---|
Taxon OID | 3300020379 Open in IMG/M |
Scaffold ID | Ga0211652_10009886 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2877 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_102 | |||||||
Coordinates | Lat. (o) | -5.2476 | Long. (o) | -85.3343 | Alt. (m) | Depth (m) | 40 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062840 | Metagenome / Metatranscriptome | 130 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211652_100098862 | F062840 | N/A | MYNKFKKGLIGNNAYLNWKTYIKKVVSACTYKRVDNTLDDTTETCGNKCAKALVKDMDKHKQLEGVLYVRLGMSILKQANG |
⦗Top⦘ |