Scaffold Ga0211527_10058890

Overview

Basic Information

• Taxon OID: 3300020378
• Scaffold ID: Ga0211527_10058890
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1179
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_038
• Coordinates
  • Lat. (^o): 19.0342
  • Long. (^o): 64.5162
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045154	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211527_100588903	F045154	N/A	VKTVNVKNKDLQNNICHRVDPSKDFTNNPPKLKLNAPRNISKGPGSFVIMFIKFVRVNFVFPSHTT