| Basic Information | |
|---|---|
| Taxon OID | 3300020374 Open in IMG/M |
| Scaffold ID | Ga0211477_10059253 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1488 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_030 | |||||||
| Coordinates | Lat. (o) | 33.93 | Long. (o) | 32.7322 | Alt. (m) | Depth (m) | 70 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065936 | Metagenome / Metatranscriptome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211477_100592535 | F065936 | AGGAG | MMTPEQGFGMLLMGIIAITIGGTIIYLIINTIEDRKIKEEKEKKEREKVDGLN |
| ⦗Top⦘ |