Scaffold Ga0211672_10009910

Overview

Basic Information

• Taxon OID: 3300020370
• Scaffold ID: Ga0211672_10009910
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2692
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_098
• Coordinates
  • Lat. (^o): -25.859
  • Long. (^o): -111.6989
  • Depth (m): 188

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099848	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211672_100099103	F099848	N/A	MDWLVEYMEDPEKRVRLFKICVLISQGMVVLGALIAIWIFRDSLENLLD