Basic Information | |
---|---|
Taxon OID | 3300020365 Open in IMG/M |
Scaffold ID | Ga0211506_1091967 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 858 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium TMED271 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_036 | |||||||
Coordinates | Lat. (o) | 20.8151 | Long. (o) | 63.5046 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084330 | Metagenome / Metatranscriptome | 112 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211506_10919672 | F084330 | AGAAGG | MASRLVSVSKNVFGKAFYSNLWIAISFGLISQVIGYTKYDGYFDLYWIIMKDGYLYFNLYPSFDELSAVLFIRVFLAVFVFLTIKDKLKGN |
⦗Top⦘ |