Scaffold Ga0211712_10048323

Overview

Basic Information

• Taxon OID: 3300020360
• Scaffold ID: Ga0211712_10048323
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX555918-ERR599165)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1058
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_070
• Coordinates
  • Lat. (^o): -20.3976
  • Long. (^o): -3.2009
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049928	Metagenome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211712_100483233	F049928	AGG	MINFVTNREYTGMNYDTLARLSKGSEFAGFHQGKKFFGVKGTDLKGMKAAASVMFVVKKTKEDGDEKKSIRYKSVFAKSDFEAAIARNRVLNPDRKVETISE