Scaffold Ga0211689_1122573

Overview

Basic Information

• Taxon OID: 3300020358
• Scaffold ID: Ga0211689_1122573
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 728
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. BACL10 MAG-120910-bin24 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_082
• Coordinates
  • Lat. (^o): -47.1906
  • Long. (^o): -58.2682
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047554	Metagenome	149	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211689_11225732	F047554	AGG	MTLEYVLKKEHVVIEDDVHAILDLKKAGEIECWAIPDYDLVAWNKEESCVFGLLKQTGGTYNLSFNVANHGEYDLELDKVLK