Scaffold Ga0211706_1000555

Overview

Basic Information

• Taxon OID: 3300020345
• Scaffold ID: Ga0211706_1000555
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX556079-ERR599137)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11790
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_072
• Coordinates
  • Lat. (^o): -8.7006
  • Long. (^o): -17.9915
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029236	Metagenome / Metatranscriptome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211706_10005552	F029236	N/A	LNRSFLSSVHAASLVDHMEMKDDTNFMNDEMNTLEKWLASSRVWLELESARLRLEAETREWEAENEVFSAETGCYGWEFIDEWL