Scaffold Ga0211570_1036796

Overview

Basic Information

• Taxon OID: 3300020344
• Scaffold ID: Ga0211570_1036796
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556104-ERR598987)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1275
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_137
• Coordinates
  • Lat. (^o): 14.2016
  • Long. (^o): -116.696
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051452	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211570_10367966	F051452	GAGG	MKILIKEIMNMLLTSRGRTFVWNPRSKFQVRRKIKDVRLTFGDNVELTFFHPLPSKTSKLFTVKPTVDCLESF