| Basic Information | |
|---|---|
| Taxon OID | 3300020342 Open in IMG/M |
| Scaffold ID | Ga0211604_1055441 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556117-ERR599036) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 799 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_124 | |||||||
| Coordinates | Lat. (o) | -9.1552 | Long. (o) | -140.5284 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004063 | Metagenome / Metatranscriptome | 455 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211604_10554412 | F004063 | N/A | KVATSTFTADGTTKAFEVDELIHEEDILVKEGDQIVFVGQGVTADNNIKPTYLTADGTLRSADHELGITLTHDTVNNKTTINFTKETPTLGTIIKVERSNDKYLKFRSKGI |
| ⦗Top⦘ |