Scaffold Ga0211571_1116074

Overview

Basic Information

• Taxon OID: 3300020338
• Scaffold ID: Ga0211571_1116074
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX555920-ERR599099)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 610
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_137
• Coordinates
  • Lat. (^o): 14.2016
  • Long. (^o): -116.696
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026708	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211571_11160742	F026708	N/A	TNGETAKKATKKRVELKVNGPILSIPVSWAMNVVPQIKLQIIKQINDIVFFIKPKLYR