Scaffold Ga0211661_1004288

Overview

Basic Information

• Taxon OID: 3300020333
• Scaffold ID: Ga0211661_1004288
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX556081-ERR598953)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5625
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_100
• Coordinates
  • Lat. (^o): -12.9057
  • Long. (^o): -96.155
  • Depth (m): 177

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010921	Metagenome / Metatranscriptome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211661_10042882	F010921	GAGG	MGTLNVKGGVKIVEGKAFIHPLSYQEIEFLLEIVANAGHKIEDMPKVMQVTKKLRNEYKLIIEHFEE