Scaffold Ga0211567_1040771

Overview

Basic Information

• Taxon OID: 3300020328
• Scaffold ID: Ga0211567_1040771
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX555937-ERR599015)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1036
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_137
• Coordinates
  • Lat. (^o): 14.1468
  • Long. (^o): -116.6821
  • Depth (m): 375

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001756	Metagenome / Metatranscriptome	641	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211567_10407712	F001756	N/A	FLILGLNIPKKKLCPKLEKNVKIRPNKITFKLKLLNIINYDL