Scaffold Ga0211673_1013262

Overview

Basic Information

• Taxon OID: 3300020323
• Scaffold ID: Ga0211673_1013262
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001027 (ERX555979-ERR599120)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1786
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_098
• Coordinates
  • Lat. (^o): -25.8126
  • Long. (^o): -111.7386
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059059	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211673_10132622	F059059	N/A	MAGQLTETEINIRKQTLESDLSAVKEQLNKLDAEKTNLVAQHHAISGAIQQCDLFLQDLMNNSGVVVDNDSSIPKSKKG