Scaffold Ga0211491_1102081

Overview

Basic Information

• Taxon OID: 3300020318
• Scaffold ID: Ga0211491_1102081
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556107-ERR598973)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_066
• Coordinates
  • Lat. (^o): -34.8986
  • Long. (^o): 18.03
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011796	Metagenome / Metatranscriptome	287	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211491_11020812	F011796	AGGTGG	MPIPKQKYKELKAYYDFQRKVSYNKEKLRGAVEVMLEQPDLLFNDIWSKMKEEEMQEAPKDWIPKDDKLKIEGEE