Scaffold Ga0211487_1116807

Overview

Basic Information

• Taxon OID: 3300020316
• Scaffold ID: Ga0211487_1116807
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX555946-ERR599134)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_033
• Coordinates
  • Lat. (^o): 22.1283
  • Long. (^o): 38.1967
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078288	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211487_11168071	F078288	N/A	VSEKIAVITFSWILSWSFTAVKQLSITYDHLTNNQSNVQAVISTPIDVDENVSAESTSKQTYSKTEVHTNDCKDKMYWDKVSLEISEDKNKAYINFPKPPAEQGIKTVSLNVHPMNSAYDRNFGFRFH