Scaffold Ga0211522_1059847

Overview

Basic Information

• Taxon OID: 3300020314
• Scaffold ID: Ga0211522_1059847
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 649
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_036
• Coordinates
  • Lat. (^o): 20.8199
  • Long. (^o): 63.5138
  • Depth (m): 17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028615	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211522_10598471	F028615	N/A	ATIDIAQKTVGPRFVNPLVDFKKPLEVIPRTIPKNKKI