NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211692_1001313

Scaffold Ga0211692_1001313


Overview

Basic Information
Taxon OID3300020303 Open in IMG/M
Scaffold IDGa0211692_1001313 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000745 (ERX556095-ERR599124)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5500
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_078
CoordinatesLat. (o)-30.3455Long. (o)-43.2924Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006198Metagenome / Metatranscriptome379Y
F011620Metagenome / Metatranscriptome289Y

Sequences

Protein IDFamilyRBSSequence
Ga0211692_10013133F011620GGAMIDKIIQVVLKFFGKEKPEPPTEENNESLEALERVEALDKIGESS
Ga0211692_10013136F006198GGAMEVELDVDCNNCNAKYTMMYEADDIRSRQEEHAFHCSFCGILMEPYYDEFFEED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.