| Basic Information | |
|---|---|
| Taxon OID | 3300020296 Open in IMG/M |
| Scaffold ID | Ga0211474_1000108 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 18700 |
| Total Scaffold Genes | 43 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 22 (51.16%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_018 | |||||||
| Coordinates | Lat. (o) | 35.7392 | Long. (o) | 14.3321 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073647 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211474_10001082 | F073647 | GGAGG | MTKMIPNDVHKALATLFKHKLINEIERQKLMEKSMRRDLSARIVQLPKPREATAALEKTLIDVVNRQGNQAFTVSEITQKVEAMVGKTTDSAVRYVLGLMVHKGKAEQIHADGRVLFGRK |
| ⦗Top⦘ |